Tesamorelin · Technical glossary

Laboratory calculation tool. Products for research only, not for human consumption

Synthetic peptide analogue of growth hormone releasing factor (GHRH).

Synonyms / identifiers: Tesamorelin · 218949-48-5 · TH9507 · MQG94M5EEO Source: PubChem CID 16137828
Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL Source: PubChem CID 16137828
Molecular formula: C221H366N72O67S Source: PubChem CID 16137828
Molecular mass: 5136 g/mol Source: PubChem CID 16137828
CAS: 218949-48-5 Source: PubChem CID 16137828
Form: Liofilizado

Biological notation transcribed from PubChem. The letter sequence does not necessarily list all chemical modifications, bonds, or components of the complex; See also the structure and IUPAC name of the CID.

PubChem references describe chemical identities; They do not validate the lot or replace its COA. A sequence that does not appear unequivocally in the records consulted remains pending verification.

Identity data comes from PubChem or the supplier catalogue, as indicated by the source. It does not analytically validate the batch. Purity is taken only from the linked report.

Tesamorelin · Batch/sample purity
Formats	Lot / Sample Reference	COA Purity of lot/sample
5mg	Pending verification	Batch COA in preparation
10mg	Batch: JUNE 2026	See COA (PDF) · 198507 99,765 %
20mg	Pending verification	Batch COA in preparation

Results relate to the analysed sample. Check it matches the received vial; publication does not establish authenticity, stock or independent verification.

Lyophilised storage

Pending verification: no validated batch storage conditions are available in the repository.

Storage after reconstitution

Pending verification: no validated batch storage conditions are available in the repository.

Temperature and stability depend on formulation, diluent and batch. Request the supplier specification; no expiry is assigned without validation.

See product · Tesamorelin Reconstitution calculator

Formats

Shipping by country

Destination

€15 per order; free from €50 in products after all discounts. Charged in EUR.

España · Menos de 7 días naturales desde el despacho. No enviamos a Canarias, Ceuta ni Melilla.

Dispatch after payment confirmation: 24 hours for stock; up to 10 calendar days if a preorder is included.

Shipping by country · Destination

Shipping by country · EU / EUR

Spain · Menos de 7 días naturales desde el despacho. No enviamos a Canarias, Ceuta ni Melilla.
Germany · Delivery in less than 7 calendar days from dispatch. If it takes 7 days or more, you receive a €15 voucher, once per customer.
Austria · Delivery in less than 7 calendar days from dispatch. If it takes 7 days or more, you receive a €15 voucher, once per customer.
Belgium · Delivery in less than 7 calendar days from dispatch. If it takes 7 days or more, you receive a €15 voucher, once per customer.
Bulgaria · Delivery in less than 7 calendar days from dispatch. If it takes 7 days or more, you receive a €15 voucher, once per customer.
Cyprus · Delivery in less than 7 calendar days from dispatch. If it takes 7 days or more, you receive a €15 voucher, once per customer.
Croatia · Delivery in less than 7 calendar days from dispatch. If it takes 7 days or more, you receive a €15 voucher, once per customer.
Denmark · Delivery in less than 7 calendar days from dispatch. If it takes 7 days or more, you receive a €15 voucher, once per customer.
Slovakia · Delivery in less than 7 calendar days from dispatch. If it takes 7 days or more, you receive a €15 voucher, once per customer.
Slovenia · Delivery in less than 7 calendar days from dispatch. If it takes 7 days or more, you receive a €15 voucher, once per customer.
Estonia · Delivery in less than 7 calendar days from dispatch. If it takes 7 days or more, you receive a €15 voucher, once per customer.
Finland · Delivery in less than 7 calendar days from dispatch. If it takes 7 days or more, you receive a €15 voucher, once per customer.
France · Delivery in less than 7 calendar days from dispatch. If it takes 7 days or more, you receive a €15 voucher, once per customer.
Greece · Delivery in less than 7 calendar days from dispatch. If it takes 7 days or more, you receive a €15 voucher, once per customer.
Hungary · Delivery in less than 7 calendar days from dispatch. If it takes 7 days or more, you receive a €15 voucher, once per customer.
Ireland · Delivery in less than 7 calendar days from dispatch. If it takes 7 days or more, you receive a €15 voucher, once per customer.
Italy · Delivery in less than 7 calendar days from dispatch. If it takes 7 days or more, you receive a €15 voucher, once per customer.
Latvia · Delivery in less than 7 calendar days from dispatch. If it takes 7 days or more, you receive a €15 voucher, once per customer.
Lithuania · Delivery in less than 7 calendar days from dispatch. If it takes 7 days or more, you receive a €15 voucher, once per customer.
Luxembourg · Delivery in less than 7 calendar days from dispatch. If it takes 7 days or more, you receive a €15 voucher, once per customer.
Malta · Delivery in less than 7 calendar days from dispatch. If it takes 7 days or more, you receive a €15 voucher, once per customer.
Netherlands · Delivery in less than 7 calendar days from dispatch. If it takes 7 days or more, you receive a €15 voucher, once per customer.
Poland · Delivery in less than 7 calendar days from dispatch. If it takes 7 days or more, you receive a €15 voucher, once per customer.
Portugal · Delivery in less than 7 calendar days from dispatch. If it takes 7 days or more, you receive a €15 voucher, once per customer.
Czechia · Delivery in less than 7 calendar days from dispatch. If it takes 7 days or more, you receive a €15 voucher, once per customer.
Romania · Delivery in less than 7 calendar days from dispatch. If it takes 7 days or more, you receive a €15 voucher, once per customer.
Sweden · Delivery in less than 7 calendar days from dispatch. If it takes 7 days or more, you receive a €15 voucher, once per customer.