Tesamorelin vs CJC-1295 + Ipamorelin · Technical comparisons
Laboratory calculation tool. Products for research only, not for human consumption
Comparison of identity, signalling models and documentation. The cited studies do not verify store materials or their stability.
| Technical comparisons | Tesamorelin | CJC-1295 + Ipamorelin |
|---|---|---|
| Structure | Synthetic peptide analogue of growth hormone releasing factor (GHRH). | Dual lyophilisate of CJC-1295 and Ipamorelin. The catalog indicates 10 mg total without detailing the proportion of each component. |
| Sequence | YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL | Pending verification |
| Molecular formula | C221H366N72O67S | Pending verification |
| Molecular mass | 5136 g/mol | Pending verification |
| CAS | 218949-48-5 | Pending verification |
| Form | Lyophilised | Lyophilised |
| Mechanism in research models | GHRH analogue according to the catalog; characterization of the pending lot. | Ipamorelin is characterized as a secretagogue in preclinical studies. CJC variant and batch ratio need confirmation. |
| Stability | Pending verification: no validated batch storage conditions are available in the repository. | Pending verification: no validated batch storage conditions are available in the repository. |
| Formats | 5mg/10mg/20mg | Blend 10 mg |
| Price per vial · VAT included | 5 mg: €49.99 / 10 mg: €89.99 / 20 mg: €164.99 | Blend 10 mg: €61.99 |
Temperature and stability depend on formulation, diluent and batch. Request the supplier specification; no expiry is assigned without validation.
Sources
Identity data comes from PubChem or the supplier catalogue, as indicated by the source. It does not analytically validate the batch. Purity is taken only from the linked report.
Tesamorelin
Technical glossary| Formats | Lot / Sample Reference | COA Purity of lot/sample |
|---|---|---|
| 5mg | Pending verification | Batch COA in preparation |
| 10mg | Batch: JUNE 2026 | See COA (PDF) · 198507 99,765 % |
| 20mg | Pending verification | Batch COA in preparation |
Results relate to the analysed sample. Check it matches the received vial; publication does not establish authenticity, stock or independent verification.
CJC-1295 + Ipamorelin
Technical glossary| Formats | Lot / Sample Reference | COA Purity of lot/sample |
|---|---|---|
| Blend 10 mg | Pending verification | Batch COA in preparation |
Results relate to the analysed sample. Check it matches the received vial; publication does not establish authenticity, stock or independent verification.
Shipping by country
€15 per order; free from €50 in products after all discounts. Charged in EUR.
España · Menos de 7 días naturales desde el despacho. No enviamos a Canarias, Ceuta ni Melilla.
Dispatch after payment confirmation: 24 hours for stock; up to 10 calendar days if a preorder is included.
Shipping by country · DestinationShipping by country · EU / EUR
- Spain · Menos de 7 días naturales desde el despacho. No enviamos a Canarias, Ceuta ni Melilla.
- Germany · Delivery in less than 7 calendar days from dispatch. If it takes 7 days or more, you receive a €15 voucher, once per customer.
- Austria · Delivery in less than 7 calendar days from dispatch. If it takes 7 days or more, you receive a €15 voucher, once per customer.
- Belgium · Delivery in less than 7 calendar days from dispatch. If it takes 7 days or more, you receive a €15 voucher, once per customer.
- Bulgaria · Delivery in less than 7 calendar days from dispatch. If it takes 7 days or more, you receive a €15 voucher, once per customer.
- Cyprus · Delivery in less than 7 calendar days from dispatch. If it takes 7 days or more, you receive a €15 voucher, once per customer.
- Croatia · Delivery in less than 7 calendar days from dispatch. If it takes 7 days or more, you receive a €15 voucher, once per customer.
- Denmark · Delivery in less than 7 calendar days from dispatch. If it takes 7 days or more, you receive a €15 voucher, once per customer.
- Slovakia · Delivery in less than 7 calendar days from dispatch. If it takes 7 days or more, you receive a €15 voucher, once per customer.
- Slovenia · Delivery in less than 7 calendar days from dispatch. If it takes 7 days or more, you receive a €15 voucher, once per customer.
- Estonia · Delivery in less than 7 calendar days from dispatch. If it takes 7 days or more, you receive a €15 voucher, once per customer.
- Finland · Delivery in less than 7 calendar days from dispatch. If it takes 7 days or more, you receive a €15 voucher, once per customer.
- France · Delivery in less than 7 calendar days from dispatch. If it takes 7 days or more, you receive a €15 voucher, once per customer.
- Greece · Delivery in less than 7 calendar days from dispatch. If it takes 7 days or more, you receive a €15 voucher, once per customer.
- Hungary · Delivery in less than 7 calendar days from dispatch. If it takes 7 days or more, you receive a €15 voucher, once per customer.
- Ireland · Delivery in less than 7 calendar days from dispatch. If it takes 7 days or more, you receive a €15 voucher, once per customer.
- Italy · Delivery in less than 7 calendar days from dispatch. If it takes 7 days or more, you receive a €15 voucher, once per customer.
- Latvia · Delivery in less than 7 calendar days from dispatch. If it takes 7 days or more, you receive a €15 voucher, once per customer.
- Lithuania · Delivery in less than 7 calendar days from dispatch. If it takes 7 days or more, you receive a €15 voucher, once per customer.
- Luxembourg · Delivery in less than 7 calendar days from dispatch. If it takes 7 days or more, you receive a €15 voucher, once per customer.
- Malta · Delivery in less than 7 calendar days from dispatch. If it takes 7 days or more, you receive a €15 voucher, once per customer.
- Netherlands · Delivery in less than 7 calendar days from dispatch. If it takes 7 days or more, you receive a €15 voucher, once per customer.
- Poland · Delivery in less than 7 calendar days from dispatch. If it takes 7 days or more, you receive a €15 voucher, once per customer.
- Portugal · Delivery in less than 7 calendar days from dispatch. If it takes 7 days or more, you receive a €15 voucher, once per customer.
- Czechia · Delivery in less than 7 calendar days from dispatch. If it takes 7 days or more, you receive a €15 voucher, once per customer.
- Romania · Delivery in less than 7 calendar days from dispatch. If it takes 7 days or more, you receive a €15 voucher, once per customer.
- Sweden · Delivery in less than 7 calendar days from dispatch. If it takes 7 days or more, you receive a €15 voucher, once per customer.